Everyone (has/have) done his or her homework.
has
have

Answers

Answer 1

Everyone [tex]\sf\purple{has}[/tex] done his or her homework.

Explanation:

Everyone is singular and, therefore, require singular verb.

[tex]\circ \: \: { \underline{ \boxed{ \sf{ \color{green}{Happy\:learning.}}}}}∘[/tex]

Answer 2

Answer:

→ has

Explanation:

Everyone has done his or her homework.


Related Questions

choose the implied meaning of burn the candle at both sides ​

Answers

it means that when something good or bad is happening the candle will hold good and bad and in many situations you will be in the middle cuz nothing ever only holds bad

The Crab That Played with the Sea

based on the details in the excerpt, what is its primary purpose?

Inform?
Describe?
Persuade?
Entertain?

Answers

The primary purpose is to explain to children that the moon causes tides

Answer:

To Inform

Explanation:

Hi you can help me plissss

Answers

Answer:

Racism, discrimination, and prejudice

Explanation:

Racism is the belief that groups of humans possess different behavioral traits corresponding to physical appearance and can be divided based on the superiority of one race over another.

Discrimination is the act of making unjustified distinctions between human beings based on the groups, classes, or other categories to which they are perceived to belong. People may be discriminated against on the basis of race, gender, age, religion, or sexual orientation.

Prejudice can be an affective feeling towards a person based on their perceived group membership. The word is often used to refer to a preconceived evaluation or classification of another person.

Racism: There are two main types of racism. The first is individual racism, which stems from one’s subconscious biases against those of another race. The second is systemic racism, which is the implementation of policies that result in the disproportionate inequality (whether this be financial, social, etc.) of specific racial groups, whether or not this is the indent of the policies.

Discrimination: This is the direct mistreatment of people based on specific things about a person or group, such as race, gender, sexual orientation, nationality, age, etc.

Prejudice: This is the preconceived notion that someone of a certain group is inferior simply because they are a part of this group. This may or may not result in discrimination.

lim catch 4 dogs anh 5 cats

Answers

ok kool

have a nice day

Read the excerpt from act 5, scene 1, of Julius Caesar.

OCTAVIUS. Come, Antony, away!
Defiance, traitors, hurl we in your teeth.
If you dare fight to-day, come to the field.
If not, when you have stomachs.

What is the tone of this passage?

regretful wishing he had been a better leader
discouraged knowing that they will lose to Brutus and Cassius
scornful suggesting Brutus and Cassius are traitors and cowards
sad when rembering the daily struggles the Roman citizens must endure

Answers

Answer:

scornful suggesting Brutus and Cassius are traitors and cowards

Explanation:

The tone of the above passage is a scornful one for it mocks Brutus and Cassius and challenges them to a fight. In this passage, Octavius considers Brutus and Cassius as traitors because they put Caesar to death. He challenges them to a fight and also believes that they will not win the fight since they are cowards running away from the city.

Antony a close friend of Caesar hopes to avenge his death and organizes his army to attack the army of Brutus and Cassius who have fled from the city.

Answer:

scornful suggesting Brutus and Cassius are traitors and cowards

Explanation:

took the test its correct bih

Which revision of this section of dialogue best shows the narrator’s feelings? When I open the cover, the smell of fresh paper wafts up to greet me and the crisp, open page fills me with an exquisite sense of possibility. When I first open the notebook, I take care to crease the cover gently so that it’s nice and flexible, and then I can enjoy writing without fussing. I’m happy about the notebook because now I can get started on writing down the song that’s been floundering in my head all week. I’m glad to have a new notebook because I’m hoping it will provide inspiration to start working on that short story that’s due in English soon.

Answers

Answer: When I open the cover, the smell of fresh paper wafts up to greet me and the crisp, open page fills me with an exquisite sense of possibility.

Explanation:

The revision of this section of dialogue best shows the narrator’s feelings is "When I open the cover, the smell of fresh paper wafts up to greet me and the crisp, open page fills me with an exquisite sense of possibility".

This implies how the narrator feels about how he feels like whenever he wants to start a new notebook.

Answer:

its a

Explanation:

Two minutes speech on online classes

Answers

Answer:

???????????what are you asking for

what Scout means when she says, "Had her conduct been more friendly toward me, I would have felt sorry for her”?​

Answers

If the person in question has been nicer to Scout upon meeting her she would have felt sorry for her

Explanation:

Maybe if she were more nicer to scoot

please help -50 points-

read this excerpt from this persuasive essay.

which sentence provides evidence that supports the writer's claim *must look at photo*

Answers

Answer:

i think the first one is the claim

Answer:

even with this....12 percent.

Explanation:

this sentence provides quantitative evidence which is the result of a study.

What does the color "gold" represent in the poem ?

This is the poem

Nature’s first green is gold,


Her hardest hue to hold.


Her early leaf’s a flower;


But only so an hour.


Then leaf subsides to leaf.


So Eden sank to grief,


So Dawn goes down to day.

Nothing gold can stay.


This is the option

A. The speaker's greed

B. The speaker's dreams

C. The slow passage of time

D. The fleeting nature of beauty.

Please no links I need help really bad! I know it not C by the way

Answers

Answer:

It is D

Explanation:

This is because he is saying that gold does not stay. The nature of beauty can also relate to this.

And also it is because I got the same question a week ago on my test

Answer:

it is answer D the fleeting nature of beauty

Mr.Thapa visits his sister once a month.(how often question)

Answers

Answer:

How often does Mr. Thapa visit his sister?

Explanation:

Changing a sentence/ statement into a "how often" question means that the sentence will be a question and must be correctly punctuated with a question mark. Also, the question will start with the "how often" phrase and pose a question that the time phrase will answer.

This means that the time phrase "once a month" is the answer. Therefore, the question will be framed according to the answer. Also, the tense of the given sentence is simple present tense. So, the question form will also have the present tense.

Thus, the correct answer will be

How often does Mr. Thapa visit his sister?

Correct the following sentence for parallelism: Helping with homework, encouraging studies, and a positive attitude are also things parents can participate in.

Answers

Answer:

pqpqpwokekeekpwqpwpskdidenfjvkfkdmekxlsksmnfngngfnfnnfnfkrkrkdkdkdkmfnfkdkslwlqplwlsldndnfnjfnfnfjrkrkrkrkrkkrjfhfhfjdjvnfmckwkxjcnrogivmai

answerrrr my question yall pls lol
Why did leaders from nearly 200 nations convene in Paris in December 2015?
1: Leaders met to determine the best place in Africa to replant about 100 million hectares (386,000 square miles) of forest by 2030.
2: Leaders convened to discuss the pressing issue of climate change and how nations can work together to combat it.
3: Leaders convened to discuss how to maintain the current level of greenhouse gases emitted into the atmosphere.
4: Leaders met to pledge funds that would be used to convince more nations to take part in the Paris Agreement initiatives.

Answers

Answer:

2. Leaders convened to discuss the pressing issue of climate change and how nations can work together to combat it.

Explanation:

Nearly 200 countries in the world, precisely, 196 countries convened in Paris in December 2015 to discuss the problem of climate change that affects everyone on the globe. This agreement falls within the framework of the United Nations Framework Convention on Climate Change. The agreement at this convention was to reduce the temperature emitted at a global level to an average of 2° Celsius or an equivalent of  3.6° Fahrenheit.

The ultimate goal however is to attain a limit of 1.5° Celsius or its equivalent of 2.7° Fahrenheit. When these goals are reached our climate will be restored and living things will have a better chance of survival.

Question for people that went/go to LSS! Brainliest for correct answer!
When you do the English assessment, do you do the Language Arts and Reading? Or just One of the two. Thank you! 30 points :)

Answers

Answer:

for me it was only 1

Explanation:

some schools or teachers use both and the reading can be considered orals

can anyone help with these underline the verb and.....​

Answers

first one is changed

Explanation:

second one is doing

Why does the speaker mention seemingly minor price increases in the second stanza? (Harlem by Langston Hughes)

Answers

Answer:

by bay ayshshsjejejjrjrjfjfjifnjfhddyjendjrhrjejidhduhsjgfjrtkdyidhjfjfyhdyrhfhjeyegf

Do you believe that our lives are dictated entirely by fate or fortune

Answers

I think a little bit of both
Yes because it all depends on how u strat your adult life so if u start of bad then most likely there will be a lot of fate

We use information from which two sources in order to determine whether an author uses a word or phrase differently than we use it now?

A) a dictionary and a thesaurus
B) a usage dictionary and a dictionary
C) the reading itself and a thesaurus
D) the reading itself and a dictionary

Answers

Answer:

I strongly believe that this questions answer is B

Explanation: When we talking about the past we must say that a lot of vocabulary are changed. Because thanks to time we forgot same vocabulary. We need to check a usage dictionary and a dictionary to get vocabulary which one used in the past. Some words means are same and some words look like same but they haven't same means for this we should check dictionary.

Answer:

D) the reading itself and a dictionary

Explanation:

Pls Help
Describe the role that poetry plays in American society today. What purpose does poetry serve, and who benefits from it?

(Remember that poetry appears in many places besides textbooks or poetry collections, including song lyrics, advertising, and spoken-word performances.)​

Answers

poetry is surprisingly popular in our day and age, many things pass off that you wouldn’t expect. rap is quite inspired by poetry and slam poetry! poetry is something we can all enjoy and helps you really stop and take in the beauty of something, it’s a breather and reminder of what’s around us.

Answer:

pepe pecas pica papas

Explanation:

The idea that in Okonkwo's language, the word for "woman" is also used to describe a man
without power suggests?

Answers

It suggests that men are superior to women and they (men) are the only ones with any power to control things in their society

Which statements provide a logical analysis of the call
to action in Queen Elizabeth's speech? Select all that
apply.
The context of awaiting an attack establishes
expectation and adds reasonability.
O The emotional language makes the audience
unlikely to support her request.
The argument builds to the call to action by
establishing the situation and eliciting strong
emotions.
O The failure to establish logos makes the queen's
request seem unreasonable.
O Though the queen asks the troops to risk their lives,
the call is appropriate given a soldier's duty.

Answers

Answer:

A,C,E

Explanation:

edge 2021

which one is the simple subject in these sentence ? A total of more of one hundred players compete in the series

Answers

series is the answer

Hey can you guys help me please!! I need this really bad. What are two overarching messages in the novel Illegal? Please help me. I need lots of help!

Answers

The main "Illegal" messages are the relationships between privilege, power and race. This can be seen in social relations in relation to race, as the story takes place in a universe where white-skinned people have guaranteed citizenship, have power social and economic, the freedom to act as they please, and all the perks that a system can promote. The black population, on the other hand, does not have this citizenship and is devalued, oppressed, exploited and even deported and killed.

"Illegal" presents the story of a society in a fictional country called the Freedom State. Despite the name, the country lives in a system of constant oppression, where the entire society is subject to governmental control, which determines who is legal within the country and those who are illegal and must be fought.

Auntie is the lady to...... I gave the list.​

Answers

Answer:

Aunty is the lady to whom whom I give the list.

Hope it helps

Which element of a text best helps the reader
determine the central dea?

Answers

Answer:

The Key Details.

I need this as soon as possible please

Answers

Answer:

promptly.

Explanation:

An adverb can be defined as a word that is used in English language to modify a verb, adjective, or another adverb. Some examples are slowly, quickly, brightly, sadly, promptly, etc.

Generally, adverbs are formed by adding the suffix "ly" to the end of a verb e.g prompt + ly = promptly.

Promptly simply means to be punctual or do something quickly and soon.

Hence, the adverb in the sentence "Reiko told me to arrive promptly at 8 p.m. in order to be on time for the dinner." is promptly.

Additionally, there are six (6) main types of adverbs and these includes;

I. Adverb of time.

II. Adverb of frequency.

III. Adverb of place.

IV. Adverb of manner.

V. Adverb of reason.

VI. Adverb of intensity.

Answer:

C

Explanation:

edge 2022

Use the poem to complete the sentences.



The first four lines of the poem make up a

.

The last two lines of the poem make up a

.

Answers

Answer:

quatrain

couplet

Explanation:

In poetry, a quatrain is a group of four lines that constitutes one stanza, or verse, of a poem. A quatrain can be a separate poem on its own or a portion inside a greater poem. The lyrical expression is taken from the “four”-meaning French word “quatre.”

What impact of couplet and quatrain in poem?

Typically, a couplet comprises two lines that follow each other, rhyme, and have the same meter. A couplet can be run-on or formal (closed) (open). Each of the two lines of a formal (or closed) couplet is end-stopped, suggesting that there is a grammatical pause at the conclusion of a line of verse.

A couplet is a literary technique composed of two lines of poem that rhyme. These occur consecutively or one after the other. The meter, or the number of syllables and stresses, of these lines is typically the same. Together, these two lines frequently complete a notion or make a statement.

Therefore, The first four lines of the poem make up a quatrain and

The last two lines of the poem make up a couplet.

Learn more about poem here:

https://brainly.com/question/14660674

#SPJ2

What is the BEST description of Anne Frank’s point of view in The Diary of a Young Girl?

She is aware of the danger from the Nazis but is not bothered by it until her older sister is called up.

Her point of view is one of anger and resentment at having to go into hiding because of the Nazis.

Her point of view is one of sadness and depression because her entire life is changed by the Nazis.

She is naive about the danger from the Nazis, but then she must face reality when they go into hiding.

Answers

Answer:

Her point of view is one of sadness and depression because her entire life is changed by the Nazis.

Explanation:

"Diary of a Young Girl" is the diary written by Anne Frank, a Jewish girl who was killed in Nazi concentration camps, but who, before that, spent three years in hiding with her family and other Jews.

She starts writing in her diary even before going into hiding, where she already shows great sadness at the devaluation and dangers Jews were living in in Nazi-dominated Europe. After going into hiding, this feeling of sadness and depression only increases, as she cannot live normally because of Nazism, they cannot be free or do anything they like. She is also very scared for everything that is happening and especially for not knowing if she will escape alive.

Answer:

She is aware of the danger from the Nazis but is not bothered by it until her older sister is called up.

Explanation:

daanger

if you know any of these please help me

Answers

Sorry I don’t know




Sorry
if you search the first question online you will see cliff notes on this topic

Who is not a round character in The Tragedy of Julius Caesar?
O Lepidus
Mark Antony
Caesar
O Brutus

Answers

Answer:

Lepidus

Explanation:

A round character is the character in the story has develops and progresses along with the progression of the story. The development of the character is carried throughout the story. In "Julius Caesar", Mark Anthony, Caesar and Brutus are the round characters. Although the murder of Caesar takes place in the initial scenes but the character of Caesar keeps developing throughout the story. On the other hand, Lepidus plays a very small part in the story. He allows Anthony and Octavius to punish his brother as his brother was also the part of the group who planned for Caesar's assassination.

Other Questions
Read the lines from "Because I Could Not Stop for Death."And I had put awayMy labor and my leisure too,For His Civility What is the purpose of the words labor and leisure?They are aspects of life that frustrate the speaker.They are elements of life that the speaker wants to show Death.They are aspects of life that the speaker is leaving.They are elements of life that the speaker will not miss. Question 9 Multiple Choice Worth 1 points)(02.05 MC)Given f(x) and g(x) = k-f(x), use the graph to determine the value of k. As an estimation we are told 3 is 4.Convert 33 to euros. what is the vertices of hexagon Calculate the heat energy conducted per hour through the side walls of a cylindrical steelboiler of 1.00 m diameter and 3.0 m long if the internal and external temperatures of thewalls are 140 C and 40 C respectively and the thickness of the walls is 6.0 mm. (Thermalconductivity of steel, k = 42 Wm-4C-4) In PQR, p = 7.6 inches, r = 3.5 inches and R=160. Find all possible values of P, to the nearest 10th of a degree. Please help !!!!!!!!!!!!!!!!! A flat (unbanked) curve on a highway has a radius of 260 mm . A car successfully rounds the curve at a speed of 32 m/sm/s but is on the verge of skidding out.Required:a. If the coefficient of static friction between the cars tires and the road surface were reduced by a factor of 2, with what maximum speed could the car round the curve?b. Suppose the coefficient of friction were increased by a factor of 2; what would be the maximum speed? We arrived in Thailand 2 days ago.-> We've.... True or false quarterbacks should not expect to have bad passes A Key Factor in Controlling Your Anger Is Using Passive behaviour.T/F Cricket chirps: Temperature Anyone who has been outdoors on a summer evening has probably heard crickets. Did you know that it is possible to use the cricket as a thermometer? Crickets tend to chirp more frequently as temperatures increase. This phenomenon was studied in detail by George W. Pierce, a physics professor at Harvard. In the following data, x is a random variable representing chirps per second and y is the random variable representing temperature (F). These data are also available for download at the online study center.X 20.0 16.0 19.8 18.4 17.1 15.5 14.7 17.1Y 88.6 71.6 93.3 84.3 80.6 75.2 69.7 82.0X 15.4 16.2 15.0 17.2 16.0 17.0 14.4Y 69.4 83.3 79.6 82.6 80.6 83.5 76.3Complete parts (a) through (e), given ?x= 249.8, ?y=1200.6, ?x^2= 4200.56, ?y^2= 96,752.86, ?xy= 20,127.47 and r = 0.835.A) Draw a scatter diagram displaying the data.B) Find X- bar, Y- bar, a and b. Then find the equation of the least squares line y=a+bx.C) Graph the least squares line on your scatter diagram. Be sure to use the point ( X-bar, Y- bar) as one of the points on the line.D) Find the value of the coefficient of determination r ^2. What percentage of the variation in y can be explained by the corresponding variation in x and the least squares line? What percentage is unexplained?E) What is the predicted temperature when x= 19 chirps per second. The following frequency distribution presents the five most frequent reasons for hospital admissions in U.S. community hospitals in a recent year.Reason Frequency (in thousands)Congestive heart failure 990Coronary atherosclerosis 1400Heart attack 744Infant birth 3800Required:a. Construct a frequency bar graph.b. Construct a relative frequency distribution.c. Construct a relative frequency bar graph.d. Construct a relative frequency Pareto chart. At Shimla, the temperature was -14C on Monday and then it dropped by 2C on Tuesday. What was the temperature of Shimla on Tuesday? Complete the passage in which a chef gives instructions to his students on how to make a traditional French dessert. Use the correct forms of the verbs provided in parentheses. Bonjour! Aujourdhui je vais vous dmontrer la recette pour la Galette des Rois au chocolat. ______________ (voir, first person plural) les ingrdients pour la prparer. Il nous faut deux rouleaux de pte feuillete, deux ufs, une fve, 100 grammes damandes en poudre, 100 grammes de chocolat dessert, 75 grammes de beurre et 50 grammes de sucre. ______________ (prchauffer, first person plural) le four 210o Celsius. ______________ (taler, formal) la pte feuillete sur une plaque garnie de papier sulfuris. ______________ (faire fondre, informal) le chocolat au bain-marie. ______________ (mlanger, first person plural) bien un jaune duf, sucre, fve et amandes avec le chocolat fondu. Maintenant, ______________ (verser, informal) la prparation au chocolat sur la pte en laissant 3 cm de rebord. ______________ (couvrir, formal) de deuxime rouleau de pte et ______________ (pincer, formal) bien les bords. ______________ (fouetter, formal) un jaune duf avec du lait et ______________ (enduire, formal) le dessus de la pte. ______________ (enfourner, formal) pendant 15 minutes. Find the missing side. Round to the nearest tenth. X=? 1. According to the birth-order effect, being theyoungest child causes someone to beA a natural mediator a strong leader more rebelliousD wealthier If the 12th term of the arithmetic sequence is 15 and the 11th term is 10, find the common difference of the sequence. SOMEONE PLEASE HELP ME! Appreciated very much!!!! I need this badly, stuck on it forever 9 divided by 1/5===================================